General Information

  • ID:  hor002208
  • Uniprot ID:  Q90WX8
  • Protein name:  Insulin-like growth factor III
  • Gene name:  igf3
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed both maternally and zygotically. Expressed in the dorsal midline during gastrulation and neurulation. Expression is strong in the prospective ventral forebrain region of the anterior neural plate.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0007399 nervous system development; GO:0030154 cell differentiation; GO:0048699 generation of neurons
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RCLRPRSKELLCGSELVDILQFICGPTGFYVSKGASFRNRNRPGIVEECCFCGCSVAILESYCAAPVTNFTG
  • Length:  72(50-121)
  • Propeptide:  MPVTAMCLQDSKKLKKAKLTRKKVTPFPFSRMVLCLSLVFTLYVEATNARCLRPRSKELLCGSELVDILQFICGPTGFYVSKGASFRNRNRPGIVEECCFCGCSVAILESYCAAPVTNFTGREEQKS
  • Signal peptide:  MPVTAMCLQDSKKLKKAKLTRKKVTPFPFSRMVLCLSLVFTLYVEATNA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Promotes anterior neural development.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  12-50; 24-63; 49-54
  • Structure ID:  AF-Q90WX8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002208_AF2.pdbhor002208_ESM.pdb

Physical Information

Mass: 912172 Formula: C342H542N96O100S8
Absent amino acids: HMW Common amino acids: CG
pI: 7.96 Basic residues: 8
Polar residues: 29 Hydrophobic residues: 24
Hydrophobicity: 20.14 Boman Index: -8888
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 79.86
Instability Index: 4921.67 Extinction Coefficient cystines: 3480
Absorbance 280nm: 49.01

Literature

  • PubMed ID:  11709186
  • Title:  Neural and head induction by insulin-like growth factor signals.